Lineage for d6c73a_ (6c73 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2414299Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2414329Protein Trp synthase alpha-subunit [51388] (8 species)
  7. 2414378Species Salmonella typhimurium [TaxId:90371] [51389] (48 PDB entries)
  8. 3062754Domain d6c73a_: 6c73 A: [362816]
    Other proteins in same PDB: d6c73b_
    automated match to d1k8ya_
    complexed with cl, cs, dms, edo, f9f, peg, plp; mutant

Details for d6c73a_

PDB Entry: 6c73 (more details), 1.65 Å

PDB Description: tryptophan synthase q114a mutant (internal aldimine state) in complex with n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9f) with cesium ion bound in the metal coordination site
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d6c73a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c73a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasra

SCOPe Domain Coordinates for d6c73a_:

Click to download the PDB-style file with coordinates for d6c73a_.
(The format of our PDB-style files is described here.)

Timeline for d6c73a_:

  • d6c73a_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-24