![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (9 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54239] (296 PDB entries) Uniprot P62988 identical sequence in many other species |
![]() | Domain d6ml1e1: 6ml1 E:-1-82 [362791] Other proteins in same PDB: d6ml1a_, d6ml1c2, d6ml1e2 automated match to d3rula_ complexed with ca, cl, edo, mes, na, zn |
PDB Entry: 6ml1 (more details), 1.9 Å
SCOPe Domain Sequences for d6ml1e1:
Sequence, based on SEQRES records: (download)
>d6ml1e1 d.15.1.1 (E:-1-82) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} aamlifvktlsgkfislevepsdtienvkakiqdkegippdqqrlifagkrlsfyrkqle dgrtlsdyniqkhstlqllvisrg
>d6ml1e1 d.15.1.1 (E:-1-82) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} aamlifvktlsgkfislevepsdtienvkakiqdkegippdqqrlifalsfyrkqledgr tlsdyniqkhstlqllvisrg
Timeline for d6ml1e1: