Lineage for d6a2sb_ (6a2s B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2818820Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
    complex fold made of several coiled beta-sheets; contains an SH3-like barrel
  4. 2818821Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) (S)
  5. 2818877Family b.87.1.0: automated matches [227255] (1 protein)
    not a true family
  6. 2818878Protein automated matches [227040] (2 species)
    not a true protein
  7. 2818879Species Mycobacterium tuberculosis [TaxId:83332] [362638] (4 PDB entries)
  8. 2818889Domain d6a2sb_: 6a2s B: [362786]
    automated match to d1i4va_
    complexed with p6g, peg

Details for d6a2sb_

PDB Entry: 6a2s (more details), 2.5 Å

PDB Description: mycobacterium tuberculosis lexa c-domain s160a
PDB Compounds: (B:) lexa repressor

SCOPe Domain Sequences for d6a2sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a2sb_ b.87.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdivaamidgeatv
ktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv

SCOPe Domain Coordinates for d6a2sb_:

Click to download the PDB-style file with coordinates for d6a2sb_.
(The format of our PDB-style files is described here.)

Timeline for d6a2sb_: