Class b: All beta proteins [48724] (180 folds) |
Fold b.87: LexA/Signal peptidase [51305] (1 superfamily) complex fold made of several coiled beta-sheets; contains an SH3-like barrel |
Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) |
Family b.87.1.0: automated matches [227255] (1 protein) not a true family |
Protein automated matches [227040] (2 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [362638] (4 PDB entries) |
Domain d6a2sb_: 6a2s B: [362786] automated match to d1i4va_ complexed with p6g, peg |
PDB Entry: 6a2s (more details), 2.5 Å
SCOPe Domain Sequences for d6a2sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a2sb_ b.87.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} dvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdivaamidgeatv ktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
Timeline for d6a2sb_: