SCOPe 2.07: Domain d6iyna1: 6iyn A:1-122

Lineage for d6iyna1 (6iyn A:1-122)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries)

8. Domain d6iyna1: 6iyn A:1-122 [362757]
   Other proteins in same PDB: d6iyna2
   automated match to d4lrnl_

Details for d6iyna1

PDB Entry: 6iyn

PDB Description: solution structure of camelid nanobody nb26 against aflatoxin b1

PDB Compounds: (A:) Nb26

SCOPe Domain Sequences for d6iyna1:

Sequence; same for both SEQRES and ATOM records:

>d6iyna1 b.1.1.0 (A:1-122) automated matches {Vicugna pacos [TaxId: 30538]}
mqlqlvesggglvqaggslrlscaasgrtfssyamgwfrqapgkerefvavvnwsgrrty
yadsvkgrftisrdnakntvylqmnslkpedtavyncaagkwdgsyygapdywgqgtqvt
vs

Timeline for d6iyna1:

• d6iyna1 is new in SCOPe 2.07-stable
  
• d6iyna1 appears in the current release, SCOPe 2.08