![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
![]() | Protein automated matches [190230] (23 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187072] (51 PDB entries) |
![]() | Domain d6crna1: 6crn A:280-624 [362750] Other proteins in same PDB: d6crna2, d6crnd2, d6crne_, d6crnf_, d6crng_, d6crnh_ automated match to d2hd5a1 complexed with zn |
PDB Entry: 6crn (more details), 2.5 Å
SCOPe Domain Sequences for d6crna1:
Sequence, based on SEQRES records: (download)
>d6crna1 d.3.1.0 (A:280-624) automated matches {Human (Homo sapiens) [TaxId: 9606]} grnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfdnplgmrgeia ksyaelikqmwsgkfsyvtprafktqvgrfapqfsgyqqqdcqellaflldglhedlnri rkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcpecakisvtfd pfcyltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqatkkldlwslpp vlvvhlkrfsysrymrdkldtlvdfpindldmseflinpnagpcrynliavsnhyggmgg ghytafaknkddgkwyyfddssvstasedqivskaayvlfyqrqd
>d6crna1 d.3.1.0 (A:280-624) automated matches {Human (Homo sapiens) [TaxId: 9606]} grnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfdnplgmrgeia ksyaelikqmwsgkfsyvtprafktqvgrfapqfsgyqqqdcqellaflldglhedlnri rkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcpecakisvtfd pfcyltlplpmpkkpfvklkdcielfttkeklpwycpnckehqqatkkldlwslppvlvv hlkrfsysrymrdkldtlvdfpindldmseflinpnagpcrynliavsnhyggmggghyt afaknkddgkwyyfddssvstasedqivskaayvlfyqrqd
Timeline for d6crna1: