SCOPe 2.08: Domain d6h1fa1: 6h1f A:2-127

Lineage for d6h1fa1 (6h1f A:2-127)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d6h1fa1: 6h1f A:2-127 [362715]
   Other proteins in same PDB: d6h1fa2, d6h1fb_
   automated match to d4ocmc_
   complexed with scn

Details for d6h1fa1

PDB Entry: 6h1f, 1.9 Å

PDB Description: structure of the nanobody-stabilized gelsolin d187n variant (second domain)

PDB Compounds: (A:) gelsolin nanobody, Nb11

SCOPe Domain Sequences for d6h1fa1:

Sequence; same for both SEQRES and ATOM records:

>d6h1fa1 b.1.1.1 (A:2-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasgrtfssfvmgwfrqapgkerefvasisrsgsvtrya
dsakgrftiskdnakntvslqmdnlnpddtavyycaadlhrpygpgsqrtddydtwgqgt
qvtvss

Timeline for d6h1fa1:

• d6h1fa1 first appeared in SCOPe 2.07