Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Synechococcus sp. [TaxId:64471] [362702] (12 PDB entries) |
Domain d6gkaa_: 6gka A: [362708] automated match to d5u1ba_ complexed with cl, fe |
PDB Entry: 6gka (more details), 1.76 Å
SCOPe Domain Sequences for d6gkaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gkaa_ a.25.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 64471]} vaqgpngralaesmnpdllsaiqqhisieryasvtylamsiwcaerelagfyqffdgeak deqshavhftqyliarsqsndlqtldaprqnwdslaslmatafqmeadttssiqsvyala ernsdtrttvfldplieaqiqsedqfayllgrvkfangdptallvidnelragqtqrg
Timeline for d6gkaa_: