Lineage for d6a6qa_ (6a6q A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720315Protein automated matches [190089] (9 species)
    not a true protein
  7. 2720358Species Phanerochaete chrysosporium [TaxId:273507] [362699] (2 PDB entries)
  8. 2720361Domain d6a6qa_: 6a6q A: [362700]
    automated match to d1b80a_
    complexed with ca, gol, heb

Details for d6a6qa_

PDB Entry: 6a6q (more details), 1.67 Å

PDB Description: crystal structure of a lignin peroxidase isozyme h8 variant that is stable at very acidic ph
PDB Compounds: (A:) Ligninase H8

SCOPe Domain Sequences for d6a6qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a6qa_ a.93.1.1 (A:) automated matches {Phanerochaete chrysosporium [TaxId: 273507]}
kratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiaisprmea
qgkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafagrvals
ncpgapqmnfftgrapatqpapdglvpepfhtvdqiiervndagefdelelvwmlsahsv
aavndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgeiriqsd
etiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqskpipgn
lpfsffpagktikdveqacaetpfptlttlpgpetsvqrippppg

SCOPe Domain Coordinates for d6a6qa_:

Click to download the PDB-style file with coordinates for d6a6qa_.
(The format of our PDB-style files is described here.)

Timeline for d6a6qa_: