Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) |
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Chicken (Gallus gallus) [TaxId:9031] [53962] (184 PDB entries) |
Domain d5lyma_: 5lym A: [36268] |
PDB Entry: 5lym (more details), 1.8 Å
SCOP Domain Sequences for d5lyma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lyma_ d.2.1.2 (A:) Lysozyme {Chicken (Gallus gallus)} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d5lyma_: