SCOPe 2.08: Domain d6bhla_: 6bhl A:

Lineage for d6bhla_ (6bhl A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
   automatically mapped to Pfam PF02126

6. Protein automated matches [190258] (3 species)
   not a true protein

7. Species Brevundimonas diminuta [TaxId:293] [194088] (25 PDB entries)

8. Domain d6bhla_: 6bhl A: [362677]
   automated match to d1qw7a_
   complexed with cac, mpd, zn

Details for d6bhla_

PDB Entry: 6bhl, 1.4 Å

PDB Description: phosphotriesterase variant s5deltal7

PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d6bhla_:

Sequence; same for both SEQRES and ATOM records:

>d6bhla_ c.1.9.3 (A:) automated matches {Brevundimonas diminuta [TaxId: 293]}
gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
gvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflre
iqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqa
aileseglspsrvcighsdatddlsyltalaargyligldsiphsaigledirswqtral
likalidqgytkqilvsndwlfgissyvtnimdvmdsgnpdgmafiplrvipflrekgip
qetlagitvtnparflsptl

Timeline for d6bhla_:

• d6bhla_ first appeared in SCOPe 2.07