Lineage for d5zwta1 (5zwt A:3-80)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316392Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2316393Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2316513Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2316514Protein automated matches [191038] (21 species)
    not a true protein
  7. 2316546Species Leishmania major [TaxId:5664] [259666] (3 PDB entries)
  8. 3062557Domain d5zwta1: 5zwt A:3-80 [362619]
    Other proteins in same PDB: d5zwta2, d5zwtb2
    automated match to d2lola_
    mutant

Details for d5zwta1

PDB Entry: 5zwt (more details), 2 Å

PDB Description: crystal structure of the s37a mutant of apo-acyl carrier protein from leishmania major
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d5zwta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zwta1 a.28.1.0 (A:3-80) automated matches {Leishmania major [TaxId: 5664]}
dvltrvlevvknfekvdaskvtpeshfvkdlglnaldvvevvfaieqefildipdhdaek
iqsipdaveyiaqnpmak

SCOPe Domain Coordinates for d5zwta1:

Click to download the PDB-style file with coordinates for d5zwta1.
(The format of our PDB-style files is described here.)

Timeline for d5zwta1:

  • d5zwta1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5zwta2