Lineage for d6mqia_ (6mqi A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395948Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2396009Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 2396016Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (68 PDB entries)
  8. 3062553Domain d6mqia_: 6mqi A: [362615]
    automated match to d4yfqa_
    complexed with ret; mutant

Details for d6mqia_

PDB Entry: 6mqi (more details), 1.87 Å

PDB Description: crystal structure of the all-trans retinal bound r111k:y134f:t54v:r132q:p39y:r59y:l121q mutant of human cellular retinoic acid binding protein ii irradiated with 400 nm laser for 5 minutes at 1.87 angstrom resolution
PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d6mqia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mqia_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskyaveikqegdtfyikvsttvyt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtkeltndgeli
qtmtaddvvctqvfvre

SCOPe Domain Coordinates for d6mqia_:

Click to download the PDB-style file with coordinates for d6mqia_.
(The format of our PDB-style files is described here.)

Timeline for d6mqia_:

  • d6mqia_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17