SCOPe 2.08: Domain d5zg0e_: 5zg0 E:

Lineage for d5zg0e_ (5zg0 E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [189807] (8 PDB entries)

8. Domain d5zg0e_: 5zg0 E: [362614]
   Other proteins in same PDB: d5zg0d2
   automated match to d2xhda_
   complexed with 9c3, act, glu, zn

Details for d5zg0e_

PDB Entry: 5zg0, 1.58 Å

PDB Description: crystal structure of the glua2o lbd in complex with glutamate and compound-1

PDB Compounds: (E:) Glutamate receptor 2

SCOPe Domain Sequences for d5zg0e_:

Sequence; same for both SEQRES and ATOM records:

>d5zg0e_ c.94.1.1 (E:) Glutamate receptor ligand binding core {Human (Homo sapiens) [TaxId: 9606]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlkln
eqglldklknkwwydkgecg

Timeline for d5zg0e_:

• d5zg0e_ first appeared in SCOPe 2.07