Lineage for d5z48b1 (5z48 B:1-211)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2464564Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2465970Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 2466033Family c.56.4.0: automated matches [191433] (1 protein)
    not a true family
  6. 2466034Protein automated matches [190623] (5 species)
    not a true protein
  7. 3062451Species Deinococcus radiodurans [TaxId:243230] [362513] (3 PDB entries)
  8. 3062537Domain d5z48b1: 5z48 B:1-211 [362599]
    Other proteins in same PDB: d5z48a2, d5z48b2
    automated match to d2ebja_
    complexed with dms, na, pca

Details for d5z48b1

PDB Entry: 5z48 (more details), 1.55 Å

PDB Description: crystal structure of pyrrolidone carboxylate peptidase i from deinococcus radiodurans r1 bound to pyroglutamate
PDB Compounds: (B:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d5z48b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z48b1 c.56.4.0 (B:1-211) automated matches {Deinococcus radiodurans [TaxId: 243230]}
mptllltgfepfhthpdnpsaqaaqelhglelpggwgvhsallpvephaagaaltrllse
qdpgavlltglaagrpqvtlervgvgvmdfqipdnagqtyrdqpiepdapaaylatlplr
ailaawreaeipgdisnsaglyvcnfvlyhalhwlrehgrgavpcgflhvpanaavalav
padrpplpylpqseitravrvaaeaitaqss

SCOPe Domain Coordinates for d5z48b1:

Click to download the PDB-style file with coordinates for d5z48b1.
(The format of our PDB-style files is described here.)

Timeline for d5z48b1:

  • d5z48b1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5z48b2