SCOPe 2.08: Domain d6mugl2: 6mug L:109-210

Lineage for d6mugl2 (6mug L:109-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6mugl2: 6mug L:109-210 [362568]
   Other proteins in same PDB: d6mugd_, d6muge_, d6mugh1, d6mugh2, d6mugl1
   automated match to d1jvka2
   complexed with jys, nag

Details for d6mugl2

PDB Entry: 6mug, 2.95 Å

PDB Description: crystal structure of hiv-1 b41 sosip.664 prefusion env trimer bound to small molecule hiv-1 entry inhibitor bms-386150 in complex with human antibodies 3h109l and 35o22 at 3.8 angstrom

PDB Compounds: (L:) 3H109L Fab light chain

SCOPe Domain Sequences for d6mugl2:

Sequence; same for both SEQRES and ATOM records:

>d6mugl2 b.1.1.2 (L:109-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpmqwkmhksyscqvthegstvektvapt

Timeline for d6mugl2:

• d6mugl2 first appeared in SCOPe 2.07