Lineage for d5znia_ (5zni A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2464564Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2464581Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2464582Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2464698Protein Purine nucleoside phosphorylase, PNP [53169] (13 species)
  7. 2464922Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [226822] (5 PDB entries)
  8. 3062493Domain d5znia_: 5zni A: [362555]
    automated match to d3phca_
    complexed with po4, ymz

Details for d5znia_

PDB Entry: 5zni (more details), 2.3 Å

PDB Description: plasmodium falciparum purine nucleoside phosphorylase in complex with mefloquine
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d5znia_:

Sequence, based on SEQRES records: (download)

>d5znia_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve
melatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklat
kya

Sequence, based on observed residues (ATOM records): (download)

>d5znia_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve
melatlmvigtlrkvktggilivdgcpfkhqlenmikialgacaklatkya

SCOPe Domain Coordinates for d5znia_:

Click to download the PDB-style file with coordinates for d5znia_.
(The format of our PDB-style files is described here.)

Timeline for d5znia_:

  • d5znia_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17