Lineage for d5zg3c_ (5zg3 C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2485908Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2486861Protein automated matches [190140] (34 species)
    not a true protein
  7. 2486956Species Human (Homo sapiens) [TaxId:9606] [189406] (15 PDB entries)
  8. 3062485Domain d5zg3c_: 5zg3 C: [362547]
    Other proteins in same PDB: d5zg3d2
    automated match to d2xhda_
    complexed with 9c6, act, glu, zn

Details for d5zg3c_

PDB Entry: 5zg3 (more details), 1.65 Å

PDB Description: crystal structure of the glua2o lbd in complex with glutamate and tak- 137
PDB Compounds: (C:) Glutamate receptor 2

SCOPe Domain Sequences for d5zg3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zg3c_ c.94.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlkln
eqglldklknkwwydkgecg

SCOPe Domain Coordinates for d5zg3c_:

Click to download the PDB-style file with coordinates for d5zg3c_.
(The format of our PDB-style files is described here.)

Timeline for d5zg3c_:

  • d5zg3c_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17