Lineage for d6mtnl2 (6mtn L:109-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751268Domain d6mtnl2: 6mtn L:109-210 [362533]
    Other proteins in same PDB: d6mtnd_, d6mtne_, d6mtnh1, d6mtnh2, d6mtnl1
    automated match to d1jvka2
    complexed with jyj, nag

Details for d6mtnl2

PDB Entry: 6mtn (more details), 2.5 Å

PDB Description: crystal structure of hiv-1 bg505 sosip.664 prefusion env trimer bound to small molecule hiv-1 entry inhibitor compound 484 in complex with human antibodies 3h109l and 35o22 at 3.0 angstrom
PDB Compounds: (L:) 3H109L Fab light chain

SCOPe Domain Sequences for d6mtnl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mtnl2 b.1.1.2 (L:109-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpmqwkmhksyscqvthegstvektvapt

SCOPe Domain Coordinates for d6mtnl2:

Click to download the PDB-style file with coordinates for d6mtnl2.
(The format of our PDB-style files is described here.)

Timeline for d6mtnl2:

2751268
d6mtnl2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6mtnl1