![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
![]() | Protein automated matches [190857] (53 species) not a true protein |
![]() | Species Clostridium kluyveri [TaxId:431943] [362526] (1 PDB entry) |
![]() | Domain d6nj1a_: 6nj1 A: [362527] automated match to d4hbta_ complexed with cl |
PDB Entry: 6nj1 (more details), 1.4 Å
SCOPe Domain Sequences for d6nj1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nj1a_ e.3.1.0 (A:) automated matches {Clostridium kluyveri [TaxId: 431943]} diqynsafsqlesdygaklgvyafdtetnkevayraddrfaycstfkalaagavlkqdsl eqlkqlvkykkedvlsyapiakdnvdkgmtieeicsaairfsdntaanlllnhiggpkgf ksalnqlgdsvtqpvhiepelnegipgdigdtstprqlatdlqayttgniltedkkkili dwmagnttgntliragapkswivadksgtgpygrrndiaivmppnkkpiiiailsthdtk eakyddkliakaskiifdsftt
Timeline for d6nj1a_: