Lineage for d6nj1a_ (6nj1 A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (53 species)
    not a true protein
  7. 3062464Species Clostridium kluyveri [TaxId:431943] [362526] (1 PDB entry)
  8. 3062465Domain d6nj1a_: 6nj1 A: [362527]
    automated match to d4hbta_
    complexed with cl

Details for d6nj1a_

PDB Entry: 6nj1 (more details), 1.4 Å

PDB Description: crystal structure of class a beta-lactamase from clostridium kluyveri dsm 555
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6nj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nj1a_ e.3.1.0 (A:) automated matches {Clostridium kluyveri [TaxId: 431943]}
diqynsafsqlesdygaklgvyafdtetnkevayraddrfaycstfkalaagavlkqdsl
eqlkqlvkykkedvlsyapiakdnvdkgmtieeicsaairfsdntaanlllnhiggpkgf
ksalnqlgdsvtqpvhiepelnegipgdigdtstprqlatdlqayttgniltedkkkili
dwmagnttgntliragapkswivadksgtgpygrrndiaivmppnkkpiiiailsthdtk
eakyddkliakaskiifdsftt

SCOPe Domain Coordinates for d6nj1a_:

Click to download the PDB-style file with coordinates for d6nj1a_.
(The format of our PDB-style files is described here.)

Timeline for d6nj1a_:

  • d6nj1a_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17