Lineage for d6q5ea_ (6q5e A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575889Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2576049Family f.4.3.3: Ligand-gated protein channel [56948] (5 proteins)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. 2576088Protein automated matches [238352] (2 species)
    not a true protein
  7. 3046501Species Pseudomonas aeruginosa [TaxId:208964] [346563] (8 PDB entries)
  8. 3062453Domain d6q5ea_: 6q5e A: [362515]
    automated match to d1fepa_
    complexed with eb4, fe, lp5

Details for d6q5ea_

PDB Entry: 6q5e (more details), 2.7 Å

PDB Description: crystal structure of the ferric enterobactin receptor from pseudomonas aeruginosa (pfea) in complex with enterobactin
PDB Compounds: (A:) ferric enterobactin receptor

SCOPe Domain Sequences for d6q5ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q5ea_ f.4.3.3 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
tkqapgvsiitaediakrppsndlsqiirtmpgvnltgnsssgqrgnnrqidirgmgpen
tlilvdgkpvssrnsvrygwrgerdsrgdtnwvpadqverievirgpaaarygngaaggv
vniitkqagaethgnlsvysnfpqhkaegasermsfglngpltenlsyrvygniaktdsd
dwdinaghesnrtgkqagtlpagregvrnkdidgllswrltpeqtlefeagfsrqgniyt
gdtqntnsnnyvkqmlghetnrmyretysvthrgewdfgsslaylqyektrnsrinegla
ggtegifdpnnagfytatlrdltahgevnlplhlgyeqtltlgsewteqklddpssntqn
teeggsipglagknrsssssarifslfaednielmpgtmltpglrwdhhdivgdnwspsl
nlshaltervtlkagiaraykapnlyqlnpdyllysrgqgcygqstscylrgndglkaet
svnkelgieyshdglvagltyfrndyknkiesglspvdhasggkgdyanaaiyqwenvpk
avveglegtltlpladglkwsnnltymlqsknketgdvlsvtprytlnsmldwqatddls
lqatvtwygkqkpkkydyhgdrvtgsandqlspyaiaglggtyrlsknlslgagvdnlfd
krlfragnaqgvvgidgagaatynepgrtfytsltasf

SCOPe Domain Coordinates for d6q5ea_:

Click to download the PDB-style file with coordinates for d6q5ea_.
(The format of our PDB-style files is described here.)

Timeline for d6q5ea_:

  • d6q5ea_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17