Lineage for d6n8ua1 (6n8u A:2-80)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (178 species)
    not a true protein
  7. 2458662Species Schistosoma japonicum [TaxId:6182] [225614] (9 PDB entries)
  8. 3062444Domain d6n8ua1: 6n8u A:2-80 [362506]
    Other proteins in same PDB: d6n8ua2, d6n8ub2
    automated match to d3isoa1

Details for d6n8ua1

PDB Entry: 6n8u (more details), 1.96 Å

PDB Description: draft model of schistosoma japonicum glutathione s-transferase expression tag
PDB Compounds: (A:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d6n8ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n8ua1 c.47.1.0 (A:2-80) automated matches {Schistosoma japonicum [TaxId: 6182]}
spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
dvkltqsmaiiryiadkhn

SCOPe Domain Coordinates for d6n8ua1:

Click to download the PDB-style file with coordinates for d6n8ua1.
(The format of our PDB-style files is described here.)

Timeline for d6n8ua1:

  • d6n8ua1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from same chain:
(mouse over for more information)
d6n8ua2