Lineage for d6mj6c2 (6mj6 C:116-204)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (854 PDB entries)
  8. 3062434Domain d6mj6c2: 6mj6 C:116-204 [362496]
    Other proteins in same PDB: d6mj6a1, d6mj6a2, d6mj6b_, d6mj6c1, d6mj6d1, d6mj6d2
    automated match to d2pyfa2
    complexed with bma, fuc, gol, jtm, na, nag

Details for d6mj6c2

PDB Entry: 6mj6 (more details), 2.45 Å

PDB Description: crystal structure of the mcd1d/xxx (jj166) /inktcr ternary complex
PDB Compounds: (C:) T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN,Human nkt tcr alpha chain

SCOPe Domain Sequences for d6mj6c2:

Sequence, based on SEQRES records: (download)

>d6mj6c2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d6mj6c2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnfacanafnnsiipedtffps

SCOPe Domain Coordinates for d6mj6c2:

Click to download the PDB-style file with coordinates for d6mj6c2.
(The format of our PDB-style files is described here.)

Timeline for d6mj6c2:

  • d6mj6c2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17