Lineage for d6njca1 (6njc A:22-220)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2440037Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2440158Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 2440159Protein automated matches [191059] (14 species)
    not a true protein
  7. 3062419Species Bacteroides vulgatus [TaxId:435590] [362481] (1 PDB entry)
  8. 3062420Domain d6njca1: 6njc A:22-220 [362482]
    Other proteins in same PDB: d6njca2, d6njcb2
    automated match to d4hf7a_
    complexed with acy, cl, fmt, gol, mg

Details for d6njca1

PDB Entry: 6njc (more details), 1.9 Å

PDB Description: crystal structure of the sialate o-acetylesterase from bacteroides vulgatus
PDB Compounds: (A:) Sialate O-acetylesterase

SCOPe Domain Sequences for d6njca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6njca1 c.23.10.0 (A:22-220) automated matches {Bacteroides vulgatus [TaxId: 435590]}
erkystfyeqratlfeelpvtskdiiflgnsitngcewaelfqnknvknrgisgdicmgv
ydrldpivkgkpakiflligindvsrgtsadkiiseismivrkikqespktklylqsvlp
vndcygmfnghtsrwqvvkqindlleplavkegvayidlyshfveketgkmnpvytndgl
hllgkgyllwrdivkpyvd

SCOPe Domain Coordinates for d6njca1:

Click to download the PDB-style file with coordinates for d6njca1.
(The format of our PDB-style files is described here.)

Timeline for d6njca1:

  • d6njca1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from same chain:
(mouse over for more information)
d6njca2