Lineage for d6n9gc_ (6n9g C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399257Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2399432Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2399433Protein automated matches [190568] (7 species)
    not a true protein
  7. 2399542Species Mouse (Mus musculus) [TaxId:10090] [188331] (2 PDB entries)
  8. 3062408Domain d6n9gc_: 6n9g C: [362470]
    automated match to d2pbib_

Details for d6n9gc_

PDB Entry: 6n9g (more details), 2.13 Å

PDB Description: crystal structure of rgs7-gbeta5 dimer
PDB Compounds: (C:) Guanine nucleotide-binding protein subunit beta-5

SCOPe Domain Sequences for d6n9gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n9gc_ b.69.4.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tdglhenetlaslkseaeslkgkleeeraklhdvelhqvaervealgqfvmktrrtlkgh
gnkvlcmdwckdkrrivsssqdgkvivwdsfttnkehavtmpctwvmacayapsgcaiac
ggldnkcsvypltfdknenmaakkksvamhtnylsacsftnsdmqiltasgdgtcalwdv
esgqllqsfhghgadvlcldlapsetgntfvsggcdkkamvwdmrsgqcvqafethesdv
nsvryypsgdafasgsddatcrlydlradrevaiyskesiifgassvdfslsgrllfagy
ndytinvwdvlkgsrvsilfghenrvstlrvspdgtafcsgswdhtlrvwa

SCOPe Domain Coordinates for d6n9gc_:

Click to download the PDB-style file with coordinates for d6n9gc_.
(The format of our PDB-style files is described here.)

Timeline for d6n9gc_:

  • d6n9gc_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from other chains:
(mouse over for more information)
d6n9gd_