SCOPe 2.08: Domain d6miya1: 6miy A:6-185

Lineage for d6miya1 (6miy A:6-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d6miya1: 6miy A:6-185 [362447]
   Other proteins in same PDB: d6miya2, d6miyb_, d6miyc1, d6miyc2, d6miyd1, d6miyd2, d6miye2, d6miyf_, d6miyg1, d6miyg2, d6miyh1, d6miyh2
   automated match to d1zt4c2
   complexed with cl, gol, jtv, na

Details for d6miya1

PDB Entry: 6miy, 2.75 Å

PDB Description: crystal structure of the mcd1d/xxa (jj239)/inktcr ternary complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6miya1:

Sequence; same for both SEQRES and ATOM records:

>d6miya1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d6miya1:

• d6miya1 first appeared in SCOPe 2.07