Lineage for d1dxja_ (1dxj A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1632228Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
    automatically mapped to Pfam PF00182
  6. 1632229Protein Plant class II chitinase [53957] (2 species)
  7. 1632234Species Jack bean (Canavalia ensiformis) [TaxId:3823] [53959] (1 PDB entry)
  8. 1632235Domain d1dxja_: 1dxj A: [36244]
    complexed with so4

Details for d1dxja_

PDB Entry: 1dxj (more details), 1.8 Å

PDB Description: structure of the chitinase from jack bean
PDB Compounds: (A:) class II chitinase

SCOPe Domain Sequences for d1dxja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxja_ d.2.1.1 (A:) Plant class II chitinase {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
dvgsvidaslfdqllkhrndpacegkgfysynafvtaarsfggfgttgdtntrkrevaaf
laqtshettggaagspdgpyawgycfvterdksnkycdpgtpcpagksyygrgpiqlthn
ynyaqagralgvdlinnpdlvardavisfktaiwfwmtpqgnkpschdvitnrwtpsaad
vaanrtpgfgvitniinggiecgrgpspasgdrigfykrycdvlhlsygpnlncrdqrpf
gg

SCOPe Domain Coordinates for d1dxja_:

Click to download the PDB-style file with coordinates for d1dxja_.
(The format of our PDB-style files is described here.)

Timeline for d1dxja_: