Lineage for d6nkja_ (6nkj A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2523683Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2523697Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2523901Family d.68.2.0: automated matches [191521] (1 protein)
    not a true family
  6. 2523902Protein automated matches [190878] (14 species)
    not a true protein
  7. 2523949Species Streptococcus pneumoniae [TaxId:170187] [337266] (2 PDB entries)
  8. 3062373Domain d6nkja_: 6nkj A: [362435]
    automated match to d5wi5a_
    complexed with 0v5, cit, cl, edo

Details for d6nkja_

PDB Entry: 6nkj (more details), 1.3 Å

PDB Description: 1.3 angstrom resolution crystal structure of udp-n-acetylglucosamine 1-carboxyvinyltransferase from streptococcus pneumoniae in complex with (2r)-2-(phosphonooxy)propanoic acid.
PDB Compounds: (A:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1

SCOPe Domain Sequences for d6nkja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nkja_ d.68.2.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
mdkivvqggdnrlvgsvtiegaknavlpllaatilasegktvlqnvpilsdvfimnqvvg
glnakvdfdeeahlvkvdatgditeeapykyvskmrasivvlgpilarvghakvsmpggc
tigsrpidlhlkgleamgvkisqtagyieakaerlhgahiymdfpsvgatqnlmmaatla
dgvtvienaarepeivdlaillnemgakvkgagtetititgveklhgtthnvvqdrieag
tfmvaaamtggdvlirdavwehnrpliakllemgvevieedegirvrsqlenlkavhvkt
lphpgfptdmqaqftalmtvakgestmvetvfenrfqhleemrrmglhseiirdtarivg
gqplqgaevlstdlrasaaliltglvaqgetvvgklvhldrgyygfheklaqlgakiqri
e

SCOPe Domain Coordinates for d6nkja_:

Click to download the PDB-style file with coordinates for d6nkja_.
(The format of our PDB-style files is described here.)

Timeline for d6nkja_:

  • d6nkja_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17