Lineage for d2baa__ (2baa -)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 405476Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 405477Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 405478Family d.2.1.1: Family 19 glycosidase [53956] (1 protein)
  6. 405479Protein Plant class II chitinase [53957] (2 species)
  7. 405480Species Barley (Hordeum vulgare) [TaxId:4513] [53958] (2 PDB entries)
  8. 405483Domain d2baa__: 2baa - [36243]

Details for d2baa__

PDB Entry: 2baa (more details), 1.8 Å

PDB Description: the refined crystal structure of an endochitinase from hordeum vulgare l. seeds to 1.8 angstroms resolution

SCOP Domain Sequences for d2baa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2baa__ d.2.1.1 (-) Plant class II chitinase {Barley (Hordeum vulgare)}
svssivsraqfdrmllhrndgacqakgfytydafvaaaaafpgfgttgsadaqkrevaaf
laqtshettggwatapdgafawgycfkqergassdyctpsaqwpcapgkryygrgpiqls
hnynygpagraigvdllanpdlvatdatvgfktaiwfwmtaqppkpsshaviagqwspsg
adraagrvpgfgvitniinggiecghgqdsrvadrigfykrycdilgvgygnnldcysqr
pfa

SCOP Domain Coordinates for d2baa__:

Click to download the PDB-style file with coordinates for d2baa__.
(The format of our PDB-style files is described here.)

Timeline for d2baa__: