Lineage for d6nbma2 (6nbm A:146-428)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2422501Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2422949Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2422950Protein automated matches [226923] (75 species)
    not a true protein
  7. 3062355Species Legionella pneumophila [TaxId:446] [362417] (1 PDB entry)
  8. 3062356Domain d6nbma2: 6nbm A:146-428 [362418]
    Other proteins in same PDB: d6nbma1, d6nbma3, d6nbmb1, d6nbmb3
    automated match to d3qtpa2
    complexed with mg, po4

Details for d6nbma2

PDB Entry: 6nbm (more details), 1.9 Å

PDB Description: crystal structure of enolase from legionella pneumophila bound to phosphate and magnesium
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d6nbma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nbma2 c.1.11.0 (A:146-428) automated matches {Legionella pneumophila [TaxId: 446]}
mmtmpvpmmnilnggahadnnvdiqefmimpigapdfpvalqmgteifhvlksvlkkqgl
ntavgdeggfapniqsnrqaldllseaiekagfrlgedivfaldvaaselfnegfyhmys
enqkfdshqlieyyanlissypivsiedgldekdwsgwkqltthlgnkvqlvgddlfvtn
pkilregiaqgianailikvnqigtlsetrqaiklaydngyrcvmshrsgetedtfiadl
avasgcgqiktgslcrtdrtakynqllrinelaslpyagknil

SCOPe Domain Coordinates for d6nbma2:

Click to download the PDB-style file with coordinates for d6nbma2.
(The format of our PDB-style files is described here.)

Timeline for d6nbma2:

  • d6nbma2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17