SCOPe 2.08: Domain d6nbma1: 6nbm A:9-145

Lineage for d6nbma1 (6nbm A:9-145)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:446] [362415] (1 PDB entry)

8. Domain d6nbma1: 6nbm A:9-145 [362416]
   Other proteins in same PDB: d6nbma2, d6nbma3, d6nbmb2, d6nbmb3
   automated match to d3qtpa1
   complexed with mg, po4

Details for d6nbma1

PDB Entry: 6nbm, 1.9 Å

PDB Description: crystal structure of enolase from legionella pneumophila bound to phosphate and magnesium

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d6nbma1:

Sequence; same for both SEQRES and ATOM records:

>d6nbma1 d.54.1.0 (A:9-145) automated matches {Legionella pneumophila [TaxId: 446]}
mhihkiqareildsrgnptieadvtlttgiigrasvpsgastgsreacelrdndpkryag
kgvqkavkhvnneinqalqglsvedqenldrilcqldntenkshlganailatslacara
ralslnqplymtlnqgd

Timeline for d6nbma1:

• d6nbma1 first appeared in SCOPe 2.07