Lineage for d6nbma1 (6nbm A:9-145)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2515158Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2515159Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2515455Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2515456Protein automated matches [226922] (90 species)
    not a true protein
  7. 3062353Species Legionella pneumophila [TaxId:446] [362415] (1 PDB entry)
  8. 3062354Domain d6nbma1: 6nbm A:9-145 [362416]
    Other proteins in same PDB: d6nbma2, d6nbma3, d6nbmb2, d6nbmb3
    automated match to d3qtpa1
    complexed with mg, po4

Details for d6nbma1

PDB Entry: 6nbm (more details), 1.9 Å

PDB Description: crystal structure of enolase from legionella pneumophila bound to phosphate and magnesium
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d6nbma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nbma1 d.54.1.0 (A:9-145) automated matches {Legionella pneumophila [TaxId: 446]}
mhihkiqareildsrgnptieadvtlttgiigrasvpsgastgsreacelrdndpkryag
kgvqkavkhvnneinqalqglsvedqenldrilcqldntenkshlganailatslacara
ralslnqplymtlnqgd

SCOPe Domain Coordinates for d6nbma1:

Click to download the PDB-style file with coordinates for d6nbma1.
(The format of our PDB-style files is described here.)

Timeline for d6nbma1:

  • d6nbma1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17