Lineage for d6mjqg1 (6mjq G:2-115)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1129 PDB entries)
  8. 3062330Domain d6mjqg1: 6mjq G:2-115 [362392]
    Other proteins in same PDB: d6mjqa1, d6mjqb_, d6mjqc2, d6mjqe1, d6mjqf_, d6mjqg2
    automated match to d2pyfa1
    complexed with bma, fuc, gol, jud, man, na, nag

Details for d6mjqg1

PDB Entry: 6mjq (more details), 3 Å

PDB Description: crystal structure of the mcd1d/xxp (jj295) /inktcr ternary complex
PDB Compounds: (G:) T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6mjqg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mjqg1 b.1.1.0 (G:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

SCOPe Domain Coordinates for d6mjqg1:

Click to download the PDB-style file with coordinates for d6mjqg1.
(The format of our PDB-style files is described here.)

Timeline for d6mjqg1:

  • d6mjqg1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17