Lineage for d0rst__ (0rst -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 251696Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 251697Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 251698Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)
  6. Protein RNase St [53949] (1 species)
  7. Species Streptomyces erythreus [53950] (1 PDB entry)
  8. Domain d0rst__: 0rst - [36237]

Details for d0rst__

PDB Entry: 0rst (more details)

PDB Description: transferase(phosphotransferase)

SCOP Domain Sequences for d0rst__:

Sequence, based on SEQRES records: (download)

>d0rst__ d.1.1.2 (-) RNase St {Streptomyces erythreus}
qapcgdtsgfeevrladlppeatdtyeliekggpypypedgtvfenregilpdcaegyyh
eytvktpsgddrgarrfvvgdggeyfytedhyesfrltivn

SCOP Domain Coordinates for d0rst__:

Click to download the PDB-style file with coordinates for d0rst__.
(The format of our PDB-style files is described here.)

Timeline for d0rst__: