Lineage for d5q01b_ (5q01 B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570739Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2570740Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2570741Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 2570953Protein automated matches [190281] (5 species)
    not a true protein
  7. 2570957Species Human (Homo sapiens) [TaxId:9606] [187709] (48 PDB entries)
  8. 3062275Domain d5q01b_: 5q01 B: [362337]
    automated match to d1rdza_
    complexed with 95g

Details for d5q01b_

PDB Entry: 5q01 (more details), 2.6 Å

PDB Description: human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, e.c.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-[4-(4,5-dichloro-2-methylpyrazol-3- yl)oxyphenyl]sulfonylurea
PDB Compounds: (B:) Fructose-1,6-bisphosphatase 1

SCOPe Domain Sequences for d5q01b_:

Sequence, based on SEQRES records: (download)

>d5q01b_ e.7.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvntltrfvmeegrkargtgeltqllnslctavkaissavrkagiahlygiagstnvtgd
qvkkldvlsndlvmnmlkssfatcvlvseedkhaiivepekrgkyvvcfdpldgssnidc
lvsvgtifgiyrkkstdepsekdalqpgrnlvaagyalygsatmlvlamdcgvncfmldp
aigefilvdkdvkikkkgkiyslnegyakdfdpavteyiqrkkfppdnsapygaryvgsm
vadvhrtlvyggiflypankkspngklrllyecnpmayvmekaggmattgkeavldvipt
dihqrapvilgspddvleflkvyekhs

Sequence, based on observed residues (ATOM records): (download)

>d5q01b_ e.7.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvntltrfvmeegrkargtgeltqllnslctavkaissavrkagiahlygiagkldvlsn
dlvmnmlkssfatcvlvseedkhaiivepekrgkyvvcfdpldgssnidclvsvgtifgi
yrkkstdepsekdalqpgrnlvaagyalygsatmlvlamdcgvncfmldpaigefilvdk
dvkikkkgkiyslnegyakdfdpavteyiqrkkfppdnsapygaryvgsmvadvhrtlvy
ggiflypankkspngklrllyecnpmayvmekaggmattgkeavldviptdihqrapvil
gspddvleflkvyekhs

SCOPe Domain Coordinates for d5q01b_:

Click to download the PDB-style file with coordinates for d5q01b_.
(The format of our PDB-style files is described here.)

Timeline for d5q01b_:

  • d5q01b_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17