Lineage for d6mtje_ (6mtj E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1129 PDB entries)
  8. 3062267Domain d6mtje_: 6mtj E: [362329]
    Other proteins in same PDB: d6mtjl2
    automated match to d2rhea_
    complexed with 83g, bma, man, nag

Details for d6mtje_

PDB Entry: 6mtj (more details), 2.34 Å

PDB Description: crystal structure of hiv-1 bg505 sosip.664 prefusion env trimer bound to small molecule hiv-1 entry inhibitor bms-378806 in complex with human antibodies 3h109l and 35o22 at 2.9 angstrom
PDB Compounds: (E:) 35O22 scFv light chain portion

SCOPe Domain Sequences for d6mtje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mtje_ b.1.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapgisp
rfsgyksywsayltisdlrpedettyyccsythnsgcvfgtgtkv

SCOPe Domain Coordinates for d6mtje_:

Click to download the PDB-style file with coordinates for d6mtje_.
(The format of our PDB-style files is described here.)

Timeline for d6mtje_:

  • d6mtje_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17