Lineage for d6ma8a_ (6ma8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2331534Protein automated matches [190068] (10 species)
    not a true protein
  7. 2331553Species Human (Homo sapiens) [TaxId:9606] [189507] (64 PDB entries)
  8. 3062256Domain d6ma8a_: 6ma8 A: [362318]
    automated match to d5te8a_
    complexed with dms, edo, gol, hem, pmf

Details for d6ma8a_

PDB Entry: 6ma8 (more details), 1.83 Å

PDB Description: human cyp3a4 bound to pmsf
PDB Compounds: (A:) cytochrome p450 3a4

SCOPe Domain Sequences for d6ma8a_:

Sequence, based on SEQRES records: (download)

>d6ma8a_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlait
dpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkem
vpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfve
ntkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtq
khrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyelathp
dvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveing
mfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigm
rfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrd

Sequence, based on observed residues (ATOM records): (download)

>d6ma8a_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlait
dpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkem
vpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfve
ntkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledrv
dflqlmidsqnshkalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqee
idavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvv
mipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmkl
alirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrd

SCOPe Domain Coordinates for d6ma8a_:

Click to download the PDB-style file with coordinates for d6ma8a_.
(The format of our PDB-style files is described here.)

Timeline for d6ma8a_:

  • d6ma8a_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17