![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (4 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.0: automated matches [191412] (1 protein) not a true family |
![]() | Protein automated matches [190568] (7 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188331] (2 PDB entries) |
![]() | Domain d6n9gd_: 6n9g D: [362311] automated match to d2pbib_ |
PDB Entry: 6n9g (more details), 2.13 Å
SCOPe Domain Sequences for d6n9gd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n9gd_ b.69.4.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} atdglhenetlaslkseaeslkgkleeeraklhdvelhqvaervealgqfvmktrrtlkg hgnkvlcmdwckdkrrivsssqdgkvivwdsfttnkehavtmpctwvmacayapsgcaia cggldnkcsvypltfdknenmaakkksvamhtnylsacsftnsdmqiltasgdgtcalwd vesgqllqsfhghgadvlcldlapsetgntfvsggcdkkamvwdmrsgqcvqafethesd vnsvryypsgdafasgsddatcrlydlradrevaiyskesiifgassvdfslsgrllfag yndytinvwdvlkgsrvsilfghenrvstlrvspdgtafcsgswdhtlrvwa
Timeline for d6n9gd_: