![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (24 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1129 PDB entries) |
![]() | Domain d6mj4d2: 6mj4 D:113-240 [362304] Other proteins in same PDB: d6mj4a1, d6mj4b_, d6mj4c2 automated match to d3q5ya2 protein/RNA complex; complexed with fuc, gol, jtg, na, nag |
PDB Entry: 6mj4 (more details), 2 Å
SCOPe Domain Sequences for d6mj4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mj4d2 b.1.1.0 (D:113-240) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d6mj4d2: