Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d6miva2: 6miv A:186-279 [362292] Other proteins in same PDB: d6miva1, d6mivb_, d6mivc2 automated match to d1zt4c1 complexed with gol, ju1, na, nag |
PDB Entry: 6miv (more details), 2.05 Å
SCOPe Domain Sequences for d6miva2:
Sequence, based on SEQRES records: (download)
>d6miva2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
>d6miva2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwyl qatldveageeaglacrvkhsslggqdiilyw
Timeline for d6miva2: