Lineage for d6nd3b_ (6nd3 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434269Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2434270Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2434363Family c.7.1.0: automated matches [275322] (1 protein)
    not a true family
  6. 2434364Protein automated matches [275324] (4 species)
    not a true protein
  7. 2434368Species Desulfovibrio alaskensis [TaxId:207559] [323257] (6 PDB entries)
  8. 3062223Domain d6nd3b_: 6nd3 B: [362285]
    automated match to d5faub_
    complexed with btl

Details for d6nd3b_

PDB Entry: 6nd3 (more details), 2.36 Å

PDB Description: wild-type choline tma lyase in complex with betaine aldehyde
PDB Compounds: (B:) Choline trimethylamine-lyase

SCOPe Domain Sequences for d6nd3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nd3b_ c.7.1.0 (B:) automated matches {Desulfovibrio alaskensis [TaxId: 207559]}
gipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetap
lviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreev
fpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmld
iqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrk
aelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyrad
idsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatn
dltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmml
akgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpd
mgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgr
dvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqil
adclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllga
sangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpe
genglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckd
vqdeiisrtmlhgf

SCOPe Domain Coordinates for d6nd3b_:

Click to download the PDB-style file with coordinates for d6nd3b_.
(The format of our PDB-style files is described here.)

Timeline for d6nd3b_:

  • d6nd3b_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17