Lineage for d6nhsa_ (6nhs A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (53 species)
    not a true protein
  7. 3062219Species Nostoc sp. [TaxId:103690] [362281] (1 PDB entry)
  8. 3062220Domain d6nhsa_: 6nhs A: [362282]
    automated match to d2iwca_
    complexed with cl, edo, fmt

Details for d6nhsa_

PDB Entry: 6nhs (more details), 2 Å

PDB Description: crystal structure of the beta lactamase class d ybxi from nostoc
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6nhsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nhsa_ e.3.1.0 (A:) automated matches {Nostoc sp. [TaxId: 103690]}
nvnlgrsfnqlgikgsiliydrnnkkfyehnaarnsqsflpastfkifnslvaletgvis
ndvailtwdgmqrqfptwnqdtnirqafrnstvwfyqvlarkighermekfikqvgygnl
qigtpeqidrfwlegplqitpkqqieflqrlhrkelpfsqrtldlvqdimiyertpnyvl
rgktgwaasvtpnigwfvgyleqnnnvyffatnidirnnddaaarievtrrslkalgll

SCOPe Domain Coordinates for d6nhsa_:

Click to download the PDB-style file with coordinates for d6nhsa_.
(The format of our PDB-style files is described here.)

Timeline for d6nhsa_:

  • d6nhsa_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17