Lineage for d6nioa_ (6nio A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2485908Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2486861Protein automated matches [190140] (33 species)
    not a true protein
  7. 3062217Species Yersinia pestis [TaxId:632] [362279] (1 PDB entry)
  8. 3062218Domain d6nioa_: 6nio A: [362280]
    automated match to d1amfa_
    complexed with acy, fmt, nhe

Details for d6nioa_

PDB Entry: 6nio (more details), 1.37 Å

PDB Description: crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis
PDB Compounds: (A:) Molybdate ABC transporter substrate-binding protein

SCOPe Domain Sequences for d6nioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nioa_ c.94.1.1 (A:) automated matches {Yersinia pestis [TaxId: 632]}
dkitvfaaasltnalqdiavqykqekqvdvvasyassstlarqieqgapadlfisadqqw
mdyaidkqqivantrytllgnelvliapqdsqidkveidkktdwkklleggrlavgdpdh
vpagiyakeslenlgawstlapemarannvrsamalveraeaplgivygsdavaskkvkv
vgifpeashkpveypmaivkghdnptvtafydylkspaaavifknygftpr

SCOPe Domain Coordinates for d6nioa_:

Click to download the PDB-style file with coordinates for d6nioa_.
(The format of our PDB-style files is described here.)

Timeline for d6nioa_:

  • d6nioa_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17