Lineage for d6ncja_ (6ncj A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462855Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2463135Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2463136Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 2463142Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (60 PDB entries)
  8. 3062214Domain d6ncja_: 6ncj A: [362276]
    automated match to d3vq9c_
    complexed with edo, kjj, so4

Details for d6ncja_

PDB Entry: 6ncj (more details), 2 Å

PDB Description: structure of hiv-1 integrase with potent 5,6,7,8-tetrahydro-1,6- naphthyridine derivatives allosteric site inhibitors
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d6ncja_:

Sequence, based on SEQRES records: (download)

>d6ncja_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records): (download)

>d6ncja_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqedgiviesmnkelkkiigqvrdqaehlktavqmavfih
nhkrkggysagerivdiiatdi

SCOPe Domain Coordinates for d6ncja_:

Click to download the PDB-style file with coordinates for d6ncja_.
(The format of our PDB-style files is described here.)

Timeline for d6ncja_:

  • d6ncja_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17