Lineage for d6mu6d_ (6mu6 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757255Domain d6mu6d_: 6mu6 D: [362259]
    Other proteins in same PDB: d6mu6h2, d6mu6l2
    automated match to d5c1mb_
    complexed with jyv, nag

Details for d6mu6d_

PDB Entry: 6mu6 (more details), 2.55 Å

PDB Description: crystal structure of hiv-1 bg505 sosip.664 prefusion env trimer bound to small molecule hiv-1 entry inhibitor bms-814508 in complex with human antibodies 3h109l and 35o22 at 3.2 angstrom
PDB Compounds: (D:) 35O22 scFv heavy chain portion

SCOPe Domain Sequences for d6mu6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mu6d_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgqlvqsgatttkpgssvkiscktsgyrfnfyhinwirqtagrgpewmgwispysgdknl
apafqdrvnmttdtevpvtsftstgaaymeirnltsddtgtyfcakgllrdgsstwlpyl
wgqgtllt

SCOPe Domain Coordinates for d6mu6d_:

Click to download the PDB-style file with coordinates for d6mu6d_.
(The format of our PDB-style files is described here.)

Timeline for d6mu6d_: