![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (6 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88603] (196 PDB entries) Uniprot P01887 |
![]() | Domain d6mjqb_: 6mjq B: [362257] Other proteins in same PDB: d6mjqa1, d6mjqa2, d6mjqc1, d6mjqc2, d6mjqd1, d6mjqd2, d6mjqe1, d6mjqe2, d6mjqg1, d6mjqg2, d6mjqh1, d6mjqh2 automated match to d3gmob_ complexed with bma, fuc, gol, jud, man, na, nag |
PDB Entry: 6mjq (more details), 3 Å
SCOPe Domain Sequences for d6mjqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mjqb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} ktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdwsf yilahteftptetdtyacrvkhasmaepktvywdrdm
Timeline for d6mjqb_: