Lineage for d6gvja2 (6gvj A:754-795)

  1. Root: SCOPe 2.07
  2. 2598798Class l: Artifacts [310555] (1 fold)
  3. 2598799Fold l.1: Tags [310573] (1 superfamily)
  4. 2598800Superfamily l.1.1: Tags [310607] (1 family) (S)
  5. 2598801Family l.1.1.1: Tags [310682] (2 proteins)
  6. 2598802Protein C-terminal Tags [310895] (1 species)
  7. 2598803Species Synthetic [311502] (4870 PDB entries)
  8. 3062172Domain d6gvja2: 6gvj A:754-795 [362234]
    Other proteins in same PDB: d6gvja1
    complexed with cl, gol

Details for d6gvja2

PDB Entry: 6gvj (more details), 2.41 Å

PDB Description: human mps1 kinase domain with ordered activation loop
PDB Compounds: (A:) Dual specificity protein kinase TTK

SCOPe Domain Sequences for d6gvja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gvja2 l.1.1.1 (A:754-795) C-terminal Tags {Synthetic}
iefpdipekdlqdvlkcclkrdpkqrisipellahpyvqiqt

SCOPe Domain Coordinates for d6gvja2:

Click to download the PDB-style file with coordinates for d6gvja2.
(The format of our PDB-style files is described here.)

Timeline for d6gvja2:

  • d6gvja2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from same chain:
(mouse over for more information)
d6gvja1