Lineage for d6mczb_ (6mcz B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2335636Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2335637Species Human (Homo sapiens) [TaxId:9606] [48525] (127 PDB entries)
    Uniprot P37231 232-505
  8. 3062166Domain d6mczb_: 6mcz B: [362228]
    automated match to d2xkwa_
    complexed with acd

Details for d6mczb_

PDB Entry: 6mcz (more details), 2.1 Å

PDB Description: crystal structure of human ppargamma ligand binding domain in complex with arachidonic acid
PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d6mczb_:

Sequence, based on SEQRES records: (download)

>d6mczb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiyk

Sequence, based on observed residues (ATOM records): (download)

>d6mczb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkdkspfviydmnslmmgedkikfkhit
plkevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlas
lmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiavii
lsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvql
lqvikktetpllqeiyk

SCOPe Domain Coordinates for d6mczb_:

Click to download the PDB-style file with coordinates for d6mczb_.
(The format of our PDB-style files is described here.)

Timeline for d6mczb_:

  • d6mczb_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17