Lineage for d6miyg2 (6miy G:116-204)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (876 PDB entries)
  8. 3062146Domain d6miyg2: 6miy G:116-204 [362208]
    Other proteins in same PDB: d6miya1, d6miya2, d6miyb_, d6miyc1, d6miyd1, d6miyd2, d6miye1, d6miye2, d6miyf_, d6miyg1, d6miyh1, d6miyh2
    automated match to d2pyfa2
    complexed with cl, fuc, gol, jtv, na, nag

Details for d6miyg2

PDB Entry: 6miy (more details), 2.75 Å

PDB Description: crystal structure of the mcd1d/xxa (jj239)/inktcr ternary complex
PDB Compounds: (G:) T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6miyg2:

Sequence, based on SEQRES records: (download)

>d6miyg2 b.1.1.2 (G:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d6miyg2 b.1.1.2 (G:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnfacanafnnsiipedtffps

SCOPe Domain Coordinates for d6miyg2:

Click to download the PDB-style file with coordinates for d6miyg2.
(The format of our PDB-style files is described here.)

Timeline for d6miyg2:

  • d6miyg2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17