Lineage for d6i2ja_ (6i2j A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575889Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2576049Family f.4.3.3: Ligand-gated protein channel [56948] (5 proteins)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. 2576088Protein automated matches [238352] (2 species)
    not a true protein
  7. 3046501Species Pseudomonas aeruginosa [TaxId:208964] [346563] (8 PDB entries)
  8. 3062134Domain d6i2ja_: 6i2j A: [362196]
    automated match to d1fepa_
    complexed with eb4, fe; mutant

Details for d6i2ja_

PDB Entry: 6i2j (more details), 2.96 Å

PDB Description: crystal structure of the ferric enterobactin receptor mutant (q482a) from pseudomonas aeruginosa (pfea) in complex with enterobactin
PDB Compounds: (A:) ferric enterobactin receptor

SCOPe Domain Sequences for d6i2ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i2ja_ f.4.3.3 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
tkqapgvsiitaediakrppsndlsqiirtmpgvnltgnsssgqrgnnrqidirgmgpen
tlilvdgkpvssrnsvrygwrgerdsrgdtnwvpadqverievirgpaaarygngaaggv
vniitkqagaethgnlsvysnfpqhkaegasermsfglngpltenlsyrvygniaktdsd
dwdinaghesnrtgkqagtlpagregvrnkdidgllswrltpeqtlefeagfsrqgniyt
gdtqntnsnnyvkqmlghetnrmyretysvthrgewdfgsslaylqyektrnsrinegla
ggtegifdpnnagfytatlrdltahgevnlplhlgyeqtltlgsewteqklddpssntqn
teeggsipglagknrsssssarifslfaednielmpgtmltpglrwdhhdivgdnwspsl
nlshaltervtlkagiaraykapnlyqlnpdyllysrgagcygqstscylrgndglkaet
svnkelgieyshdglvagltyfrndyknkiesglspvdhasggkgdyanaaiyqwenvpk
avveglegtltlpladglkwsnnltymlqsknketgdvlsvtprytlnsmldwqatddls
lqatvtwygkqkpkkydyhgdrvtgsandqlspyaiaglggtyrlsknlslgagvdnlfd
krlfragnaqgvvgidgagaatynepgrtfytsltasf

SCOPe Domain Coordinates for d6i2ja_:

Click to download the PDB-style file with coordinates for d6i2ja_.
(The format of our PDB-style files is described here.)

Timeline for d6i2ja_:

  • d6i2ja_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17