Lineage for d6inta_ (6int A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424564Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2424615Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2424826Protein automated matches [190298] (2 species)
    not a true protein
  7. 3062126Species Paenibacillus sp. [TaxId:1079050] [362188] (1 PDB entry)
  8. 3062132Domain d6inta_: 6int A: [362194]
    automated match to d1a0da_
    complexed with ca

Details for d6inta_

PDB Entry: 6int (more details), 1.94 Å

PDB Description: xylose isomerase from paenibacillus sp. r4
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d6inta_:

Sequence, based on SEQRES records: (download)

>d6inta_ c.1.15.3 (A:) automated matches {Paenibacillus sp. [TaxId: 1079050]}
yfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaywhsftgngsdpfgag
talrgwnelsgmelakarveacfellnildvdyfcfhdrdiapegdtlqetnrnldeiva
likqhmhssgkkllwntanmftnprfvhgaattsnadvfayaaaqvkkaldhgkelgaen
yvfwggregyesllntdlgleldnlarflqlavdyakeigfdaqfliepkpkepskhqyd
fdaattlqflqkydlakhfklnleanhatlaghtfehelrvaringalgsidanqgdlll
gwdtdefptdlyastlamyeilqneggigrggvnfdakvrrtsfepidvvyahingmdaf
arglqvaakliedrafdnvieeryasftkgigadivsgkanfhtleayalqnnpitnksg
rvellrsilnqyiinv

Sequence, based on observed residues (ATOM records): (download)

>d6inta_ c.1.15.3 (A:) automated matches {Paenibacillus sp. [TaxId: 1079050]}
yfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaylsgmelakarveacf
ellnildvdyfcfhdrdiapegdtlqetnrnldeivalikqhmhssgkkllwntanmftn
prfvhgaattsnadvfayaaaqvkkaldhgkelgaenyvfwggregyesllntdlgleld
nlarflqlavdyakeigfdaqfliepkpkepskhqydfdaattlqflqkydlakhfklnl
eanhatlaghtfehelrvaringalgsidanqgdlllgwdtdefptdlyastlamyeilq
neggigrggvnfdakvrrtsfepidvvyahingmdafarglqvaakliedrafdnvieer
yasftkgigadivsgkanfhtleayalqnnpitnksgrvellrsilnqyiinv

SCOPe Domain Coordinates for d6inta_:

Click to download the PDB-style file with coordinates for d6inta_.
(The format of our PDB-style files is described here.)

Timeline for d6inta_:

  • d6inta_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17