Lineage for d6h3pb_ (6h3p B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338437Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2338438Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2338501Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. 2338502Protein automated matches [237402] (7 species)
    not a true protein
  7. 3062098Species Zea mays [TaxId:4577] [362160] (2 PDB entries)
  8. 3062131Domain d6h3pb_: 6h3p B: [362193]
    automated match to d4ppua_

Details for d6h3pb_

PDB Entry: 6h3p (more details), 2.7 Å

PDB Description: crystal structure of the cytoplasmic chorismate mutase from zea mays
PDB Compounds: (B:) chorismate mutase

SCOPe Domain Sequences for d6h3pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h3pb_ a.130.1.0 (B:) automated matches {Zea mays [TaxId: 4577]}
lslaavrdalvrledsvvfalierarhprnapayapaatagehslveffvreaealnaka
ghyqkpedvpffpqdlpsplfptkpspkvlhpfaslvtvndaiwkmyfdellplftvdgd
dasyaqtvaldlaclqvlsqrihigkyvaevkfkdapqeysrlikekdsnslmdmltfka
veekvkkrvekkartfgqnvtlddnatagdseckvdpkvlsklydqwvmpltkdveveyl
lrrld

SCOPe Domain Coordinates for d6h3pb_:

Click to download the PDB-style file with coordinates for d6h3pb_.
(The format of our PDB-style files is described here.)

Timeline for d6h3pb_:

  • d6h3pb_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from other chains:
(mouse over for more information)
d6h3pa_